Commit 3a016d03 authored by Mohammed Tanash's avatar Mohammed Tanash
Browse files

Merge branch 'AddExamples' into 'master'

Add Examples repo to the website

See merge request !254
parents 35f2fd24 b164ee24
#!/bin/bash
#SBATCH --nodes=1
#SBATCH --ntasks-per-node=1
#SBATCH --mem=1gb
#SBATCH --time=00:15:00
#SBATCH --job-name=blast_protein
#SBATCH --error=blast.%J.err
#SBATCH --output=blast.%J.out
#SBATCH --qos=short
module load blast/2.2.29
cp -R db/ /tmp
cp mouse.query /tmp
blastp -db /tmp/db/mouse.protein.faa -query /tmp/mouse.query -out /tmp/blast_protein.results
cp /tmp/blast_protein.results .
>gi|83029092|ref|XP_357633.3| PREDICTED: similar to Ig kappa chain V-V region L7 precursor [Mus musculus]
MRSLPASELSLPYHQDFRPDSSCPGLTDNHLLCEPTQKPRYPDLGRKRSGENRHRYRDVCISFIRRSFSALCHNPQKLRE
NLKMVSTSQLLGLLLFWTSASRCDIVMTQSPATLSVTPGDRVSLSCRASQSISDYLHWYQQKSHESPRLLIKYASQSISG
IPSRFSGSGSGSDFTLSINSVEPEDVGVYYCQNGHSFPPTMMQTIAKTSRKAEVRG
>gi|94369682|ref|XP_143371.6| PREDICTED: similar to cadherin protein [Mus musculus]
MLLEQQVKASDADAGLYGLVKYSLYDGFQSYEAPPAFQIDPQDGRICVSQDIDRERDPGTFDLLVKAKDGESLRSSHHLA
LLGGLSAQAFVRVEVDDVNDNYPVFTPSTYVTSISGQTPPGTEIINVLASDRDSGIYGTVAYELIPGDQSSLFTIDSTTG
IYSPQEDILIQDRHSAVKLTFSFDFHIKVRSLLMFLMLLRFFLCIGREDFTXQSNMNHARGWFLRLVSGRHLRNLKGKND
WPSAGNIKLAYRIRNLTFIAFEGIIYLTSTLSHLEATTIFLMVCARDGGGLTAATNADVTIHIMQTTLAPAEFERPKYTF
SVYEDVPEDTLVGTVKARESLNSSEPITYRISSGDPEGKFSIHRWLGSIRTLKPLDHEAQPMVVLTVQAQLGSSPACSST
EVNITVMDVNDNRPEFPTASDEIRISQTTPPGTALYLARAQDRDSGLNGLVRYSIASPQPSEFSMDQGRGVLYLRESLGS
KADFRLILVAKDQGVPPQVSQLVLTVVIESQERIPAVAFENLVYQVEVSESLPLTTQILQVQAYPLYPWRPTSKTFYSLD
VSVDSAVFGIHPHTGWIYLRRQLDYEFTQTYKFRVYVHTSEDRLLQNVSTSVIVHVLDENDHSPAFLQNRVFLNVEESPI
PLGVIGKMTAIDADSGKNGQLSYFLLTDGKFFKMNPNTGPGCTMFLLKMGCMQESGTRKNFSSDIFQSNLSDCFVLRQSE
LINWLALDREHQGHHQITVLVTDHGSPPRNATMLVYVTITDINDNWPFFPQCLPGKEFHFKVLEGQPVNTLVTTVFAKDL
DEGLSAELTYSISSDYPAHFKIDANNGEIRTTSILSHDYRPSYRMTVIASDHGVPPLQGKAIINIQVIPLSKGRVLMSQN
IRHLVIPENTKPSKIMSLMKSPDPLQQDHGGKLHFSIAAEDKDDHFEIDSSTGDLFLTKELDYEMTSHYLIRVISKDHSQ
SPAWNSTVFLSIDVEDQNEHSPSFQDEFIVISIEENVPVGTLVYVFNAKDGDGSFLNSRIQYFAESSSVGVNPFLIHPSS
GALVTASPLDRENVPTFILTVTASDQAVNVTDRRWRTLVAEVVILDVNDHSPTFVSYPITYVREDAEVGAVVHRITAQDP
DAEMNGEVAYSILSGNEDMVFVLDSSSGLLRIACPLDYEVKTQHILTLVAHDGGMPARSSSQTLTITVLDVNDETPAFKQ
LLYETSVKENQSPGVFVTRVEAEDTDSGVNSKHQFEIMPGPAFGLFEINPDTGEVVTAVTFDREAQGIFRLRVLVRDGGV
PSLSSTADIICTIEDENDHAPEFIVLHHDIEILENRDPEVVYTVLAFDMDAGNNGAVTYHIAEGNTDEYFAIHTTSGELS
TTRALDRELISNFTLTILCSDLGNPPRSSAMQLHVRVLDDNDHSPAFPMLHYQSSIREDAEVGTVVLVLSAVDRDEGLNG
QVEYFLMEEVSGAFTIDRVTGILRTSHALDRESRSQHTFQAVARDCSTQGAKSSVLSILISVTDANDNDPVWEENPVDAF
ISPMLALNQTVVHLRASDPDAGPNGTVTFSFADRQSVFSIDGYTGEVKLQQNLSSEHFPIWLQLLATDQGTPARTTMGLL
VVHKEGEGMKLSFSRYLYTGLVTENCEPGTSVVTVKAFAPVSSPDAITYSVVSGNEDGVFSLGSNSGQLIVEEPGLLDFE
VRSEVRLIILAESNGHQAFTQVTVAIQDWNDNPPRFAQSVYQASVSEGQFYSVHVIQVSATDLDQGLNSQIEYSIVSGNQ
AGAFRIDELNGVILTNSILDYESSGSYSLIVQATDRGVPRLSGTALVKIQVTDINDNAPVFLPSEAVEIAENSLPGVIVA
RVSVHDADLNPAFTFSLVKESSSAAKFAISQDTGVVVLAQTLDFEEVTEYELIVRVSDSVHHTEGSVIIRVLDVNDNPPV
FTQDFYQAAVPELTPGGYLVLTLSATDLESSGDISYRILSPPEGFTIDPRNGTIFTTNSVSVLEKIPTLRFLVEANDGGI
PSLTALTLVEIEIQDVNNYAPEFPAGCYNLSLSEDTPIGSTLMTFSTIDGDYSFENTHTEYSIISGNLHNYFHIETSLLG
SEHPHQQRGALVLLHALDREASASHKLVILASDHGCPPLSSTSVIAIDILDINDNAPTFSSRHYQAHVKESTPVGSHITM
VSADDPDKGSHAEIIYGIISGNEKEHFYLEDRTGVLYLVKPLDYEETVAFTLTIQATDEEEKHVSFAAVHISVLDDNDHS
PQFLSSTLACITPENLPPLSIICSVHALDFDTGPYGEVTYSIVSPCLVTHGMHPYQDLFAIDPLTGDIHTEQMLDYESVR
EYCLLVQAKDRGDASASLEVWVEVEGIDEFEPIFTQDQYFFSLREKGQGQQLIGRVEASDADAGVDGEVLYSLRTPSTVF
SVNKTNGNIYWVRAPLLGSSQLVKEDTLEVKIIAHSPKPGSKSTSCSVFVNVSLPAEGHHRTVLVHSFSISLVVSLLVFL
SLVCTLIVLILRHKQKDPLHSYEEKKTPSSPDADPKLTGAASELKAGQETAEYRGVTGPGEVMPAEWLNLMSVMEKDIIH
LFRHSNYSGHCSVDGETAEDKEIQRINENPYRKDSDYALSDQGSRVPDSGIPRDSDQLSCLSGETDVMTSSEVMEASHMF
EEGVGGEGCDVIYVQNNALSLRREATAGVLAESRRESFTSGSQEGRCVAPSTQMTSSDDVRGSYAWDYFLSWEPKFQHLA
SVFNDIARLKDEHMQVPGIPKDTSFVFPPPLITAVAQPGIKAVPPRMPAITLGQVLPKFPRSPLPYHGGSLPEVMTPNFS
PSLSLLTMQTPARSPMLPDGESRGTHMLGPWHDRKAEDEVQG
Slurm submission script for comsol job across multiple nodes.
#!/bin/bash
#SBATCH --nodes=1
#SBATCH --ntasks-per-node=4
#SBATCH --time=10:00:00
#SBATCH --mem-per-cpu=4gb
#SBATCH --error=comsol_job.%J.err
#SBATCH --output=comsol_job.%J.out
module load comsol
comsol batch -inputfile effective_diffusivity.mph -outputfile effective_diffusivity_OUT.mph -np ${SLURM_NTASKS_PER_NODE}
+++
title = "Comsol Example"
weight = "100"
+++
Comsol Example
--------------------------------------
{{< readfile file="content/submitting_jobs/app_specific/job-examples/comsol/README.md" markdown="true" >}}
{{%attachments title="Related files" style="orange" /%}}
Slurm submission script for fluent 19.2 job across multiple nodes.
#!/bin/bash
#SBATCH --nodes=1
#SBATCH --ntasks-per-node=4
#SBATCH --time=10:00:00
#SBATCH --mem-per-cpu=4gb
#SBATCH --error=job.%J.err
#SBATCH --output=job.%J.out
module load ansys/19.2
fluent 2d -t$SLURM_NTASKS -g -affinity=off -i in.file
file/read-case inlet.cas
file/read-data inlet.dat
solve/initialize/initialize-flow
solve/iterate 5000
file/write-case inlet-result.cas
file/confirm-overwrite yes
exit
yes
+++
title = "fluent-19.2 Example"
weight = "100"
+++
fluent-19.2 Example
--------------------------------------
{{< readfile file="content/submitting_jobs/app_specific/job-examples/fluent/README.md" markdown="true" >}}
{{%attachments title="Related files" style="orange" /%}}
Slurm submission script for GAMESS job across multiple nodes.
Supports Markdown
0% or .
You are about to add 0 people to the discussion. Proceed with caution.
Finish editing this message first!
Please register or to comment